Web Analysis

Our web analysis service harvested the source of this domain and found its title to be: Internetowy sklep narzędziowy - narzędzia, Bosch, elektronarzędzia, narzędzia pneumatyczne, ogrodnicze . Type of server being used is IdeaWebServer/v0.80 which is common OS being used these days. Web server is found to be in Poland. Latitudes and Longitudes are 52 and 20. This report is generated on 2012-08-15 04:56:44.

General Analysis

Server Information & SEO

Importance of this data: Ranking systems work on a number of algorithms updated almost daily by most popular search giants. They rank each site according to their own data collection tools and analysis. Google PR is one of the method of google for giving importance to site. Alexa rank builds up with visitors visiting a site. Web server displaying the type of server used by a domain.
Google Pagerank : Google Page Rank of is 2
Alexa Rank : 1,334,878 Visit Alexa
Webserver : IdeaWebServer/v0.80

Meta Information

Importance of this data: Html tag head includes several tags for search engines/bots purpose. Mostly they are used by browsers and search engines to show basic detail of a page. Most popularly used meta tags are title, description and keywords. And those are listed below.
Website title:

Internetowy sklep narzędziowy - narzędzia, Bosch, elektronarzędzia, narzędzia pneumatyczne, ogrodnicze

Description: ElektronarzdzianarzdziarczneogrodniczeipneumatyczneoferujeInternetowysklepznarzdziami.Kompresorypodnonikisprarkiruboweitokowewiertarkikosiarkiiinnemarkowenarzdziatakiejaktokarkawkrtarkapodkaszarkaczymotudarowy-BoschMetaboProxxonBlackDeckerKressJonneswaySteinelWolfcraftMakitaEinhellSkilPromaHitachiTelwiniinne.
Keywords: narzdziakosiarkikressproxxonmetaboblackdeckerkompresorykompresorwiertarkisprarkasprarkirubowetokowewiertarkawkrtarkiwkrtarkatokarkitokarkaelektronarzdziapodkaszarkapodkaszarkipodnonikpodnonikimotymotudarowyjonneswaysteinelwolfcraftboschmakitaeinhellpromaskilltelwinhitachisklepysklepznarzdziaminarzdziowyinternetowytanietaniobiaystokwbiaymstoku


Importance of this data:

Backlinks make a website strong. Bots check the number of backlinks of particular site and decides where to place it in serp. Backlinks are below.

Alexa : 157 visit Alexa

Similar Domains

Website Domain IP

Server Location

Importance of this data: This lets you know to find where is the isp is located. This helps finding competitor's isp, knowing more hosting services/providers. So you also have a better variety to choose from multiple isps you are aware of.
Country: Poland(PL)
Latitude: 52 Longitude: 20

HTTP Headers

Importance of this data:

HTTP request is followed by headers sent in a response of http request. These headers were returned when we requested to open the site on our side. These headers are respected by browsers and behaviour changes with specified header information.

HTTP/1.1 301 Moved Content-Length: 186 Content-Type: text/html Date: Wed, 15 Aug 2012 08:56:43 GMT Location: Server: IdeaWebServer/v0.80 HTTP/1.1 200 OK Cache-Control: no-store, no-cache, must-revalidate, post-check=0, pre-check=0 Content-Type: text/html Date: Wed, 15 Aug 2012 08:56:43 GMT Expires: Thu, 19 Nov 1981 08:52:00 GMT Pragma: no-cache Server: IdeaWebServer/v0.80 Transfer-Encoding: chunked Set-Cookie: PHPSESSID=3879c97d5b2d7fc811e2d4cdfdda79ab; path=/ Set-Cookie: n_baner=0; expires=Wed, 15-Aug-2012 08:57:43 GMT

WHOIS Record

Importance of this data:

Whois provider display everyone's info publicly if not hidden by owner. So ownership details including phone num, name, home and business address, etc. All information and contact details exists in whois record.

No whois server for this tld in list!

Traffic Graphs

Importance of this data:

Graphs are best way to analyse data in a second. That's why we showed you this format of data. These pictures shows plotted lines showing ups and downs in traffic. Have a look please.

Alexa Reach Rank Alexa Daily Reach Graph
Alexa Traffic Rank Alexa Traffic Graph
Compete Rank Compete Graph
Quantcast Rank Quantcast Graph
Refreshing Data
We are gathering fresh data for
Please wait while the update finishes. You will be returned to the previous page automatically.

Like Us on Google and Facebook :

Recent Recently Analyzed

Recent Privacy Concerned?

If You want to remove your site data from our database then visit This Page for Removal Instructions.